![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
![]() | Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117543] (9 PDB entries) Uniprot P13569 389-671 |
![]() | Domain d2pzfb_: 2pzf B: [205697] Other proteins in same PDB: d2pzfa2 automated match to d1l2ta_ complexed with atp, mg |
PDB Entry: 2pzf (more details), 2 Å
SCOPe Domain Sequences for d2pzfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pzfb_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]} tttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepse gkikhsgrisfcsqfswimpgtikeniigvsydeyryrsvikacqleediskfaekdniv lgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktr ilvtskmehlkkadkililhegssyfygtfselqnl
Timeline for d2pzfb_: