Lineage for d2pgca1 (2pgc A:1-206)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907199Family d.58.4.23: Marine metagenome family DABB3 [160306] (1 protein)
    duplication: consists of two similar domains; forms a pentamer similar to the Chlorite dismutase-like pentamer and the MLI decamer
  6. 1907200Protein Uncharacterized protein GOS_2596953 [160307] (1 species)
  7. 1907201Species Environmental samples [TaxId:33858] [160308] (1 PDB entry)
  8. 1907202Domain d2pgca1: 2pgc A:1-206 [149457]
    complexed with cl

Details for d2pgca1

PDB Entry: 2pgc (more details), 2.53 Å

PDB Description: crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2pgca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgca1 d.58.4.23 (A:1-206) Uncharacterized protein GOS_2596953 {Environmental samples}
msninyviltvasvdfsyretmarlmssyskdlidnagakgtrfgsigtgdhagslifiq
fyddltgyqkaleiqskssvfkeimdsgkaniylrnistslptkfeqsyehpkyivltra
eaamsdkdkflncindtascfkdngaltlrfgnlltgsnvgnyllgvgypsmeaiektyd
ellahssykelmtfakvnmrniikil

SCOPe Domain Coordinates for d2pgca1:

Click to download the PDB-style file with coordinates for d2pgca1.
(The format of our PDB-style files is described here.)

Timeline for d2pgca1: