Lineage for d2pa7a1 (2pa7 A:2-136)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080273Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 2080334Protein dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA [159287] (1 species)
  7. 2080335Species Aneurinibacillus thermoaerophilus [TaxId:143495] [159288] (4 PDB entries)
    Uniprot Q6T1W8 1-136! Uniprot Q6T1W8 2-136
  8. 2080336Domain d2pa7a1: 2pa7 A:2-136 [149339]
    complexed with cl, edo, tyd

Details for d2pa7a1

PDB Entry: 2pa7 (more details), 1.5 Å

PDB Description: Structure of Wild-Type dTDP-4-keto-6-deoxy-D-glucose-3,4-ketoisomerase from Aneurinibacillus thermoaerophilus in complex with TDP
PDB Compounds: (A:) DTDP-6-deoxy-3,4-keto-hexulose isomerase

SCOPe Domain Sequences for d2pa7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
enkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfhahkkleqvlvcl
ngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyir
qydnfkkyiakinle

SCOPe Domain Coordinates for d2pa7a1:

Click to download the PDB-style file with coordinates for d2pa7a1.
(The format of our PDB-style files is described here.)

Timeline for d2pa7a1: