Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [187981] (3 PDB entries) |
Domain d2p91d_: 2p91 D: [167082] automated match to d1d8aa_ |
PDB Entry: 2p91 (more details), 2 Å
SCOPe Domain Sequences for d2p91d_:
Sequence, based on SEQRES records: (download)
>d2p91d_ c.2.1.0 (D:) automated matches {Aquifex aeolicus [TaxId: 224324]} gllegkralitgvanersiaygiaksfhregaqlaftyatpklekrvreiakgfgsdlvv kcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvidtsregfkiamdisvy slialtrellplmegrngaivtlsyygaekvvphynvmgiakaalestvrylaydiakhg hrinaisagpvktlaaysitgfhllmehttkvnpfgkpitiedvgdtavflcsdwarait gevvhvdngyhimgv
>d2p91d_ c.2.1.0 (D:) automated matches {Aquifex aeolicus [TaxId: 224324]} gllegkralitgvanersiaygiaksfhregaqlaftyatpklekrvreiakgfgsdlvv kcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvidtsregfkiamdisvy slialtrellplmegrngaivtlsyygaekvvphynvmgiakaalestvrylaydiakhg hrinaisagpvkfgkpitiedvgdtavflcsdwaraitgevvhvdngyhimgv
Timeline for d2p91d_: