Lineage for d2p4ad_ (2p4a D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105648Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (16 PDB entries)
  8. 1105660Domain d2p4ad_: 2p4a D: [161504]
    Other proteins in same PDB: d2p4aa_, d2p4ac_
    automated match to d2p42b1
    protein/RNA complex; complexed with so4

Details for d2p4ad_

PDB Entry: 2p4a (more details), 1.9 Å

PDB Description: X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with RNASE A
PDB Compounds: (D:) antibody cab-rn05

SCOPe Domain Sequences for d2p4ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4ad_ b.1.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgypwtyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggdalvatrygrwgqgtqvtvs
s

SCOPe Domain Coordinates for d2p4ad_:

Click to download the PDB-style file with coordinates for d2p4ad_.
(The format of our PDB-style files is described here.)

Timeline for d2p4ad_: