Lineage for d2ovld2 (2ovl D:130-360)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099417Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2099418Protein automated matches [226923] (74 species)
    not a true protein
  7. 2099954Species Streptomyces coelicolor [TaxId:100226] [231096] (3 PDB entries)
  8. 2099962Domain d2ovld2: 2ovl D:130-360 [243399]
    Other proteins in same PDB: d2ovla1, d2ovla3, d2ovlb1, d2ovlb3, d2ovlc1, d2ovlc3, d2ovld1, d2ovld3
    automated match to d3bjsa2
    complexed with na

Details for d2ovld2

PDB Entry: 2ovl (more details), 2.13 Å

PDB Description: crystal structure of a racemase from streptomyces coelicolor a3(2)
PDB Compounds: (D:) Putative racemase

SCOPe Domain Sequences for d2ovld2:

Sequence, based on SEQRES records: (download)

>d2ovld2 c.1.11.0 (D:130-360) automated matches {Streptomyces coelicolor [TaxId: 100226]}
ydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlg
dsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresghtiagge
nlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvhdltvhal
asvphrtymeahgfglhaymaepmavtdgcvsapdrpghgvvldferlgrl

Sequence, based on observed residues (ATOM records): (download)

>d2ovld2 c.1.11.0 (D:130-360) automated matches {Streptomyces coelicolor [TaxId: 100226]}
ydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlg
dsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresghtiagge
nlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvhdltvhal
asvphrtymeahmavtdgcvsapdrpghgvvldferlgrl

SCOPe Domain Coordinates for d2ovld2:

Click to download the PDB-style file with coordinates for d2ovld2.
(The format of our PDB-style files is described here.)

Timeline for d2ovld2: