Lineage for d2octa_ (2oct A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935752Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 2935820Protein automated matches [190165] (2 species)
    not a true protein
  7. 2935823Species Human (Homo sapiens) [TaxId:9606] [187953] (2 PDB entries)
  8. 2935824Domain d2octa_: 2oct A: [166645]
    automated match to d1stfi_

Details for d2octa_

PDB Entry: 2oct (more details), 1.4 Å

PDB Description: stefin b (cystatin b) tetramer
PDB Compounds: (A:) Cystatin B

SCOPe Domain Sequences for d2octa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2octa_ d.17.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msgapsatqpataetqhiadqvrsqleekynkkfpvfkavsfksqvvagtnyfikvhvgd
edfvhlrvfqslphenksltlsnyqtnkakhdeltyf

SCOPe Domain Coordinates for d2octa_:

Click to download the PDB-style file with coordinates for d2octa_.
(The format of our PDB-style files is described here.)

Timeline for d2octa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2octb_