Lineage for d2o3aa1 (2o3a A:1-167)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.116: alpha/beta knot [75216] (1 superfamily)
core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knotSuperfamily c.116.1: alpha/beta knot [75217] (9 families) 
known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
all known members have dimeric structures
Family c.116.1.8: AF0751-like [159523] (1 protein)
Pfam PF01994; DUF127Protein Uncharacterized protein AF0751 [159524] (1 species) Species Archaeoglobus fulgidus [TaxId:2234] [159525] (1 PDB entry)
Uniprot O29507 1-167
Domain d2o3aa1: 2o3a A:1-167 [148570]
Details for d2o3aa1
PDB Entry: 2o3a (more details), 2.2 Å
PDB Description: crystal structure of a protein af_0751 from archaeoglobus fulgidus
PDB Compounds: (A:) UPF0106 protein AF_0751SCOPe Domain Sequences for d2o3aa1:
Sequence, based on SEQRES records: (download)
>d2o3aa1 c.116.1.8 (A:1-167) Uncharacterized protein AF0751 {Archaeoglobus fulgidus [TaxId: 2234]}
levyvlrlghrperdkristhvaltarafgakgiyfdtedksvfesvrdvverwggdffi
kavswkkllrefdglkvhltmygiplpqkleeikradkvlvvvgaekvppevyelcdlni
sigtqphsevaalavfldrvlgkvfdisfddakikvipsergkrvvs
Sequence, based on observed residues (ATOM records): (download)
>d2o3aa1 c.116.1.8 (A:1-167) Uncharacterized protein AF0751 {Archaeoglobus fulgidus [TaxId: 2234]}
levyvlrlghrpdkristhvaltarafgakgiyfdtedksvfesvrdvverwggdffika
vswkkllrefdglkvhltmygiplpqkleeikradkvlvvvgppevyelcdlnisigtqp
hsevaalavfldrvlgkvfdisfddakikvipsergkrvvs
SCOPe Domain Coordinates for d2o3aa1:
Click to download the PDB-style file with coordinates for d2o3aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o3aa1:
- d2o3aa1 first appeared in SCOP 1.75
- d2o3aa1 appears in SCOPe 2.04
- d2o3aa1 appears in SCOPe 2.06
- d2o3aa1 appears in the current release, SCOPe 2.08
View in 3D
