Class a: All alpha proteins [46456] (286 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein) |
Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species) |
Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries) |
Domain d2md9a_: 2md9 A: [256420] automated match to d2gdwa_ mutant |
PDB Entry: 2md9 (more details)
SCOPe Domain Sequences for d2md9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2md9a_ a.28.1.2 (A:) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} pvteaqyvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqv elplkvlfaqptikalaqyvatrshhhhhh
Timeline for d2md9a_: