Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.1: Pointed domain [47770] (7 proteins) |
Protein Ets-1 transcription factor pointed domain [47771] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47772] (2 PDB entries) |
Domain d2jv3a_: 2jv3 A: [166258] CASP3 |
PDB Entry: 2jv3 (more details)
SCOPe Domain Sequences for d2jv3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jv3a_ a.60.1.1 (A:) Ets-1 transcription factor pointed domain {Mouse (Mus musculus) [TaxId: 10090]} mecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavnef slkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk
Timeline for d2jv3a_: