Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
Protein automated matches [226885] (7 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [230886] (1 PDB entry) |
Domain d2j1qa2: 2j1q A:96-355 [230887] Other proteins in same PDB: d2j1qa1 automated match to d1m15a2 complexed with gol |
PDB Entry: 2j1q (more details), 1.9 Å
SCOPe Domain Sequences for d2j1qa2:
Sequence, based on SEQRES records: (download)
>d2j1qa2 d.128.1.2 (A:96-355) automated matches {Trypanosoma cruzi [TaxId: 5693]} sdkqppkdsgdlntfidvdpdkkyvistrvrcgrslegypfnpclkkqqyeemesrvkgq lesmsgelrgkyypltgmtketqkqliddhflfkegdrflqaahackfwptgrgiyhnda ktflvwvneedhlriismqkggnlkevfgrlvtavgvieekvkfsrddrlgfltfcptnl gttirasvhiklpklgadrkkleevaakynlqvrgtagehsdspdgvydisnkrrlglse yeavkemqdgilelikaees
>d2j1qa2 d.128.1.2 (A:96-355) automated matches {Trypanosoma cruzi [TaxId: 5693]} sdkqppkdsgdlntfidvdpdkkyvistrvrcgrslegypfnpclkkqqyeemesrvkgq lesmsgelrgkyypltgmtketqkqliddhflfkegdrflqaahackfwptgrgiyhnda ktflvwvneedhlriismqkggnlkevfgrlvtavgvieekvkfsrddrlgfltfcptnl gttirasvhiklprkkleevaakynlqvrgvydisnkrrlglseyeavkemqdgilelik aees
Timeline for d2j1qa2: