Lineage for d2iu4b_ (2iu4 B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) 
domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are differentFamily c.119.1.0: automated matches [191443] (1 protein)
not a true familyProtein automated matches [190655] (9 species)
not a true protein
Species Lactococcus lactis [TaxId:1358] [188636] (3 PDB entries) 
Domain d2iu4b_: 2iu4 B: [193815]
automated match to d3ct4a_
complexed with so4
Details for d2iu4b_
PDB Entry: 2iu4 (more details), 1.96 Å
PDB Description: dihydroxyacetone kinase operon co-activator dha-dhaq
PDB Compounds: (B:) dihydroxyacetone kinaseSCOPe Domain Sequences for d2iu4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iu4b_ c.119.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 1358]}
efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy
vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte
gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe
iytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklka
einwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdms
gisltlcsvkdpkwldylnvptgafawlehh
SCOPe Domain Coordinates for d2iu4b_:
Click to download the PDB-style file with coordinates for d2iu4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2iu4b_:
- d2iu4b_ first appeared in SCOPe 2.02
- d2iu4b_ appears in SCOPe 2.04
- d2iu4b_ is called d2iu4b1 in SCOPe 2.06
- d2iu4b_ appears in the current release, SCOPe 2.08, called d2iu4b1
View in 3D
