Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
Family c.119.1.0: automated matches [191443] (1 protein) not a true family |
Protein automated matches [190655] (9 species) not a true protein |
Species Lactococcus lactis [TaxId:1358] [188636] (3 PDB entries) |
Domain d2iu4b_: 2iu4 B: [193815] automated match to d3ct4a_ complexed with so4 |
PDB Entry: 2iu4 (more details), 1.96 Å
SCOPe Domain Sequences for d2iu4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iu4b_ c.119.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 1358]} efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe iytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklka einwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdms gisltlcsvkdpkwldylnvptgafawlehh
Timeline for d2iu4b_: