Lineage for d2ghwa_ (2ghw A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1689021Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 1689022Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 1689023Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
    part of PfamB PB000266
  6. 1689024Protein Spike protein S1 [143589] (1 species)
  7. 1689025Species SARS coronavirus [TaxId:227859] [143590] (8 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 1689029Domain d2ghwa_: 2ghw A: [135216]
    Other proteins in same PDB: d2ghwb1, d2ghwb2, d2ghwd1, d2ghwd2
    automated match to d2dd8s1
    complexed with cl

Details for d2ghwa_

PDB Entry: 2ghw (more details), 2.3 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain in complex with a neutralizing antibody, 80R
PDB Compounds: (A:) Spike glycoprotein

SCOPe Domain Sequences for d2ghwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghwa_ d.318.1.1 (A:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
itnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlc
fsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnyny
kyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvv
lsfellnapat

SCOPe Domain Coordinates for d2ghwa_:

Click to download the PDB-style file with coordinates for d2ghwa_.
(The format of our PDB-style files is described here.)

Timeline for d2ghwa_: