SCOPe 2.04: Domain d2ghwb1: 2ghw B:132-240

Lineage for d2ghwb1 (2ghw B:132-240)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)

8. Domain d2ghwb1: 2ghw B:132-240 [145198]
   Other proteins in same PDB: d2ghwa_, d2ghwb2, d2ghwc_, d2ghwd2
   complexed with cl

Details for d2ghwb1

PDB Entry: 2ghw, 2.3 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain in complex with a neutralizing antibody, 80R

PDB Compounds: (B:) anti-sars scFv antibody, 80R

SCOPe Domain Sequences for d2ghwb1:

Sequence; same for both SEQRES and ATOM records:

>d2ghwb1 b.1.1.1 (B:132-240) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
settltqspatlslspgeratlscrasqsvrsnlawyqqkpgqaprpliydastratgip
drfsgsgsgtdftltisrlepedfavyycqqrsnwpptfgqgtkvevks

Timeline for d2ghwb1:

• d2ghwb1 first appeared in SCOP 1.75
  
• d2ghwb1 appears in SCOPe 2.03
  
• d2ghwb1 appears in SCOPe 2.05
  
• d2ghwb1 appears in the current release, SCOPe 2.08