Lineage for d2gdma_ (2gdm A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474648Protein Leghemoglobin [46481] (2 species)
  7. 1474654Species Yellow lupine (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)
  8. 1474655Domain d2gdma_: 2gdm A: [15212]
    complexed with hem, oxy

Details for d2gdma_

PDB Entry: 2gdm (more details), 1.7 Å

PDB Description: leghemoglobin (oxy)
PDB Compounds: (A:) leghemoglobin (oxy)

SCOPe Domain Sequences for d2gdma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

SCOPe Domain Coordinates for d2gdma_:

Click to download the PDB-style file with coordinates for d2gdma_.
(The format of our PDB-style files is described here.)

Timeline for d2gdma_: