Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Leghemoglobin [46481] (2 species) |
Species Yellow lupine (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries) |
Domain d2gdma_: 2gdm A: [15212] complexed with hem, oxy |
PDB Entry: 2gdm (more details), 1.7 Å
SCOPe Domain Sequences for d2gdma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupine (Lupinus luteus) [TaxId: 3873]} galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike vvgakwseelnsawtiaydelaivikkemddaa
Timeline for d2gdma_: