Lineage for d2gclb_ (2gcl B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071535Family b.55.1.10: SSRP1-like [141436] (2 proteins)
    Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold
  6. 2071543Protein automated matches [190657] (2 species)
    not a true protein
  7. 2071544Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187743] (1 PDB entry)
  8. 2071545Domain d2gclb_: 2gcl B: [134992]
    Other proteins in same PDB: d2gcla1
    automated match to d2gcla1
    complexed with cl

Details for d2gclb_

PDB Entry: 2gcl (more details), 2.21 Å

PDB Description: structure of the pob3 middle domain
PDB Compounds: (B:) Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region

SCOPe Domain Sequences for d2gclb_:

Sequence, based on SEQRES records: (download)

>d2gclb_ b.55.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhm
mvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkne

Sequence, based on observed residues (ATOM records): (download)

>d2gclb_ b.55.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhm
mvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisrartfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkne

SCOPe Domain Coordinates for d2gclb_:

Click to download the PDB-style file with coordinates for d2gclb_.
(The format of our PDB-style files is described here.)

Timeline for d2gclb_: