Lineage for d2g03a1 (2g03 A:11-187)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1102756Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 1102757Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 1102758Family a.265.1.1: Fic-like [140932] (3 proteins)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 1102763Protein Hypothetical protein NMA0004 [140935] (1 species)
  7. 1102764Species Neisseria meningitidis [TaxId:487] [140936] (1 PDB entry)
    Uniprot Q9JQR9 11-187
  8. 1102765Domain d2g03a1: 2g03 A:11-187 [134490]
    complexed with acy, ipa

Details for d2g03a1

PDB Entry: 2g03 (more details), 2.2 Å

PDB Description: Structure of a putative cell filamentation protein from Neisseria meningitidis.
PDB Compounds: (A:) hypothetical protein NMA0004

SCOPe Domain Sequences for d2g03a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g03a1 a.265.1.1 (A:11-187) Hypothetical protein NMA0004 {Neisseria meningitidis [TaxId: 487]}
mksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggf
rfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlk
kvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqsyyyeg

SCOPe Domain Coordinates for d2g03a1:

Click to download the PDB-style file with coordinates for d2g03a1.
(The format of our PDB-style files is described here.)

Timeline for d2g03a1: