Lineage for d2fswa1 (2fsw A:3-104)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1080551Family a.4.5.69: HxlR-like [140304] (6 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
  6. 1080559Protein Hypothetical protein PG0823 [140305] (1 species)
  7. 1080560Species Porphyromonas gingivalis [TaxId:837] [140306] (1 PDB entry)
    Uniprot Q7M7B7 3-104
  8. 1080561Domain d2fswa1: 2fsw A:3-104 [134042]

Details for d2fswa1

PDB Entry: 2fsw (more details), 2.16 Å

PDB Description: Crystal Structure of the Putative Transcriptional Regualator, MarR family from Porphyromonas gingivalis W83
PDB Compounds: (A:) PG_0823 protein

SCOPe Domain Sequences for d2fswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]}
rkisdeecpvrksmqifagkwtlliifqinrriirygelkraipgisekmlidelkflcg
kglikkkqypevpprveysltplgekvlpiideiakfgmenl

SCOPe Domain Coordinates for d2fswa1:

Click to download the PDB-style file with coordinates for d2fswa1.
(The format of our PDB-style files is described here.)

Timeline for d2fswa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fswb_