Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Hypothetical protein AGR_pAT_752p/Atu5508 [142361] (1 species) putative glutathione S-transferase |
Species Agrobacterium tumefaciens [TaxId:358] [142362] (2 PDB entries) Uniprot Q7D2W7 1-87 |
Domain d2fnoa2: 2fno A:1-87 [133822] Other proteins in same PDB: d2fnoa1, d2fnoa3, d2fnob1 complexed with scn |
PDB Entry: 2fno (more details), 2 Å
SCOPe Domain Sequences for d2fnoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} medgmntfdlyywpvpfrgqlirgilahcgcswdehdvdaieglmdcgaekqpvafmgpp vlidrernfaisqmpaiaiylgerldi
Timeline for d2fnoa2: