Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (20 species) not a true protein |
Species Zoanthus sp. [TaxId:105402] [193832] (8 PDB entries) |
Domain d2fl1d_: 2fl1 D: [193880] automated match to d1xssa_ complexed with so4 |
PDB Entry: 2fl1 (more details), 2.4 Å
SCOPe Domain Sequences for d2fl1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fl1d_ d.22.1.0 (D:) automated matches {Zoanthus sp. [TaxId: 105402]} sahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcvieggplpfsedilsa afdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsaditvnvrenciyhe stfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllkdggryrcqfdt iykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp
Timeline for d2fl1d_: