Lineage for d2f5yb_ (2f5y B:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helixSuperfamily b.36.1: PDZ domain-like [50156] (7 families) 
peptide-binding domainFamily b.36.1.1: PDZ domain [50157] (47 proteins)
Pfam PF00595
Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species) Species Human (Homo sapiens) [TaxId:9606] [141264] (1 PDB entry)
Uniprot P49796 300-376
Domain d2f5yb_: 2f5y B: [133016]
automated match to d2f5ya1
complexed with so4
Details for d2f5yb_
PDB Entry: 2f5y (more details), 2.39 Å
PDB Description: Crystal Structure of the PDZ Domain from Human RGS-3
PDB Compounds: (B:) regulator of G-protein signalling 3 isoform 1SCOPe Domain Sequences for d2f5yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5yb_ b.36.1.1 (B:) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]}
mryrqitiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkc
velaheirscpseiillvwrmv
SCOPe Domain Coordinates for d2f5yb_:
Click to download the PDB-style file with coordinates for d2f5yb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f5yb_:
- d2f5yb_ first appeared in SCOP 1.73, called d2f5yb1
- d2f5yb_ appears in SCOPe 2.03
- d2f5yb_ appears in SCOPe 2.05
- d2f5yb_ appears in the current release, SCOPe 2.08, called d2f5yb2
View in 3D
