SCOP 1.73: Domain d2f5yb1: 2f5y B:19-95

Lineage for d2f5yb1 (2f5y B:19-95)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141264] (1 PDB entry)

8. Domain d2f5yb1: 2f5y B:19-95 [133016]
   automatically matched to 2F5Y A:19-95
   complexed with so4

Details for d2f5yb1

PDB Entry: 2f5y, 2.39 Å

PDB Description: Crystal Structure of the PDZ Domain from Human RGS-3

PDB Compounds: (B:) regulator of G-protein signalling 3 isoform 1

SCOP Domain Sequences for d2f5yb1:

Sequence; same for both SEQRES and ATOM records:

>d2f5yb1 b.36.1.1 (B:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]}
itiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkcvelah
eirscpseiillvwrmv

Timeline for d2f5yb1:

• d2f5yb1 is new in SCOP 1.73
  
• d2f5yb1 appears in SCOP 1.75
  
• d2f5yb1 appears in the current release, SCOPe 2.08, called d2f5yb2