Class b: All beta proteins [48724] (165 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (4 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (46 proteins) Pfam PF00595 |
Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141264] (1 PDB entry) |
Domain d2f5yb1: 2f5y B:19-95 [133016] automatically matched to 2F5Y A:19-95 complexed with so4 |
PDB Entry: 2f5y (more details), 2.39 Å
SCOP Domain Sequences for d2f5yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5yb1 b.36.1.1 (B:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} itiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkcvelah eirscpseiillvwrmv
Timeline for d2f5yb1: