Lineage for d2dwsa1 (2dws A:44-193)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381679Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
    Uniprot Q53239
  8. 2381696Domain d2dwsa1: 2dws A:44-193 [131854]
    automated match to d2dwsa1
    complexed with cu, no2

Details for d2dwsa1

PDB Entry: 2dws (more details), 1.85 Å

PDB Description: cu-containing nitrite reductase at ph 8.4 with bound nitrite
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2dwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwsa1 b.6.1.3 (A:44-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl
mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf
vyhcapggpmipwhvvsgmagcimvlprdg

SCOPe Domain Coordinates for d2dwsa1:

Click to download the PDB-style file with coordinates for d2dwsa1.
(The format of our PDB-style files is described here.)

Timeline for d2dwsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dwsa2