Lineage for d2d8ra1 (2d8r A:8-93)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965699Family g.39.1.16: THAP domain [161163] (1 protein)
    Pfam PF05485
  6. 1965700Protein THAP domain-containing protein 2 [161164] (1 species)
  7. 1965701Species Human (Homo sapiens) [TaxId:9606] [161165] (1 PDB entry)
    Uniprot Q9H0W7 1-86
  8. 1965702Domain d2d8ra1: 2d8r A:8-93 [146472]
    complexed with zn

Details for d2d8ra1

PDB Entry: 2d8r (more details)

PDB Description: solution structure of the thap domain of the human thap domain- containing protein 2
PDB Compounds: (A:) THAP domain-containing protein 2

SCOPe Domain Sequences for d2d8ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8ra1 g.39.1.16 (A:8-93) THAP domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]}
mptncaaagcattynkhinisfhrfpldpkrrkewvrlvrrknfvpgkhtflcskhfeas
cfdltgqtrrlkmdavptifdfcthi

SCOPe Domain Coordinates for d2d8ra1:

Click to download the PDB-style file with coordinates for d2d8ra1.
(The format of our PDB-style files is described here.)

Timeline for d2d8ra1: