Lineage for d2ckda1 (2ckd A:8-310)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1000507Family c.66.1.57: ML2640-like [159694] (2 proteins)
    Pfam PF02409; O-methyltransferase N-terminus (DUF142); most similar structure to the Leucine carboxy methyltransferase Ppm1 family
  6. 1000508Protein Putative methyltransferase ML2640 [159695] (1 species)
  7. 1000509Species Mycobacterium leprae [TaxId:1769] [159696] (1 PDB entry)
    Uniprot Q9CCZ4 8-310
  8. 1000510Domain d2ckda1: 2ckd A:8-310 [146409]
    Other proteins in same PDB: d2ckdb_

Details for d2ckda1

PDB Entry: 2ckd (more details), 2.8 Å

PDB Description: crystal structure of ml2640 from mycobacterium leprae
PDB Compounds: (A:) putative s-adenosyl-l-methionine-dependent methyltransferase ml2640

SCOPe Domain Sequences for d2ckda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckda1 c.66.1.57 (A:8-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]}
wdiktsvgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamldpsmvakve
aidaeaaamvehmrsyqavrtnffdtyfnnavidgirqfvilasgldsrayrldwptgtt
vyeidqpkvlayksttlaehgvtptadrrevpidlrqdwppalrsagfdpsartawlaeg
llmylpataqdglfteigglsavgsriavetsplhgdewreqmqlrfrrvsdalgfeqav
dvqeliyhdenravvadwlnrhgwrataqsapdemrrvgrwgdgvpmaddkdafaefvta
hrl

SCOPe Domain Coordinates for d2ckda1:

Click to download the PDB-style file with coordinates for d2ckda1.
(The format of our PDB-style files is described here.)

Timeline for d2ckda1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ckdb_