Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Cerianthus membranaceus [TaxId:208460] [188528] (1 PDB entry) |
Domain d2c9ja_: 2c9j A: [163344] automated match to d1uisa_ |
PDB Entry: 2c9j (more details), 1.35 Å
SCOPe Domain Sequences for d2c9ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9ja_ d.22.1.0 (A:) automated matches {Cerianthus membranaceus [TaxId: 208460]} nlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqygfr aftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvnfp pngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgqpl pgfhfikhrlvktkvepgfkmveqaeyatahvcdlp
Timeline for d2c9ja_: