Lineage for d2bv6a1 (2bv6 A:6-140)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
The N- and C-terminal helical extensions to the common fold form the dimer interface
Protein Transcriptional regulator MgrA [158272] (1 species) Species Staphylococcus aureus [TaxId:1280] [158273] (1 PDB entry)
Uniprot Q7A1J9 6-141
Domain d2bv6a1: 2bv6 A:6-140 [146218]
Other proteins in same PDB: d2bv6a2
complexed with so4
Details for d2bv6a1
PDB Entry: 2bv6 (more details), 2.8 Å
PDB Description: crystal structure of mgra, a global regulator and major virulence determinant in staphylococcus aureus
PDB Compounds: (A:) hth-type transcriptional regulator mgraSCOPe Domain Sequences for d2bv6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bv6a1 a.4.5.28 (A:6-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]}
nlkeqlcfslynaqrqvnryysnkvfkkynltypqflvltilwdespvnvkkvvtelald
tgtvspllkrmeqvdlikrersevdqrevfihltdksetirpelsnasdkvasasslsqd
evkelnrllgkviha
SCOPe Domain Coordinates for d2bv6a1:
Click to download the PDB-style file with coordinates for d2bv6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bv6a1:
- d2bv6a1 first appeared in SCOP 1.75
- d2bv6a1 appears in SCOPe 2.07
View in 3D
