Lineage for d2btya1 (2bty A:1-282)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1181576Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1181577Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1181596Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. 1181597Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 1181613Species Thermotoga maritima [TaxId:2336] [142720] (1 PDB entry)
    Uniprot Q9X2A4 1-282
  8. 1181614Domain d2btya1: 2bty A:1-282 [129161]
    Other proteins in same PDB: d2btyb_, d2btyc_
    complexed with arg, k, nlg

Details for d2btya1

PDB Entry: 2bty (more details), 2.75 Å

PDB Description: acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine
PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d2btya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]}
mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
avsavrggvgavhiingglehailleifsrkgigtmikeleg

SCOPe Domain Coordinates for d2btya1:

Click to download the PDB-style file with coordinates for d2btya1.
(The format of our PDB-style files is described here.)

Timeline for d2btya1: