Lineage for d2bnga1 (2bng A:13-144)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936854Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
    automatically mapped to Pfam PF07858
  6. 2936929Protein Uncharacterized protein Mb2760 [159963] (1 species)
  7. 2936930Species Mycobacterium tuberculosis [TaxId:1773] [159964] (1 PDB entry)
    Uniprot Q7TY00 13-144
  8. 2936931Domain d2bnga1: 2bng A:13-144 [146156]
    Other proteins in same PDB: d2bngb_, d2bngc_
    complexed with ca

Details for d2bnga1

PDB Entry: 2bng (more details), 2.5 Å

PDB Description: structure of an m.tuberculosis leh-like epoxide hydrolase
PDB Compounds: (A:) mb2760

SCOPe Domain Sequences for d2bnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]}
etteairaveaflnalqnedfdtvdaalgddlvyenvgfsrirggrrtatllrrmqgrvg
fevkihrigadgaavltertdaliigplrvqfwvcgvfevddgritlwrdyfdvydmfkg
llrglvalvvps

SCOPe Domain Coordinates for d2bnga1:

Click to download the PDB-style file with coordinates for d2bnga1.
(The format of our PDB-style files is described here.)

Timeline for d2bnga1: