Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
Protein tRNA adenosine deaminase TadA [142840] (3 species) |
Species Staphylococcus aureus [TaxId:1280] [142841] (1 PDB entry) Uniprot Q99W51 1-151 |
Domain d2b3ja1: 2b3j A:1-151 [127787] protein/RNA complex; complexed with gol, zn |
PDB Entry: 2b3j (more details), 2 Å
SCOPe Domain Sequences for d2b3ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3ja1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Staphylococcus aureus [TaxId: 1280]} mtndiyfmtlaieeakkaaqlgevpigaiitkddeviarahnlretlqqptahaehiaie raakvlgswrlegctlyvtlepcvmcagtivmsriprvvygaddpkggcsgslmnllqqs nfnhraivdkgvlkeacstllttffknlran
Timeline for d2b3ja1: