Lineage for d2b3ja1 (2b3j A:1-151)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187156Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1187157Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1187232Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 1187280Protein tRNA adenosine deaminase TadA [142840] (3 species)
  7. 1187289Species Staphylococcus aureus [TaxId:1280] [142841] (1 PDB entry)
    Uniprot Q99W51 1-151
  8. 1187290Domain d2b3ja1: 2b3j A:1-151 [127787]
    protein/RNA complex; complexed with gol, zn

Details for d2b3ja1

PDB Entry: 2b3j (more details), 2 Å

PDB Description: Crystal Structure of Staphylococcus aureus tRNA Adenosine Deaminase, TadA, in Complex with RNA
PDB Compounds: (A:) tRNA adenosine deaminase

SCOPe Domain Sequences for d2b3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3ja1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Staphylococcus aureus [TaxId: 1280]}
mtndiyfmtlaieeakkaaqlgevpigaiitkddeviarahnlretlqqptahaehiaie
raakvlgswrlegctlyvtlepcvmcagtivmsriprvvygaddpkggcsgslmnllqqs
nfnhraivdkgvlkeacstllttffknlran

SCOPe Domain Coordinates for d2b3ja1:

Click to download the PDB-style file with coordinates for d2b3ja1.
(The format of our PDB-style files is described here.)

Timeline for d2b3ja1: