Lineage for d2alaa1 (2ala A:293-380)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) 
Protein Fusion glycoprotein E1 [74840] (1 species) Species Semliki forest virus [TaxId:11033] [74841] (4 PDB entries) 
Domain d2alaa1: 2ala A:293-380 [126973]
Other proteins in same PDB: d2alaa2
automatically matched to d1i9wa1
Details for d2alaa1
PDB Entry: 2ala (more details), 3 Å
PDB Description: Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric conformation.
PDB Compounds: (A:) Structural polyprotein (P130)SCOPe Domain Sequences for d2alaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2alaa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasc
SCOPe Domain Coordinates for d2alaa1:
Click to download the PDB-style file with coordinates for d2alaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2alaa1:
- d2alaa1 first appeared in SCOP 1.73
- d2alaa1 appears in SCOPe 2.02
- d2alaa1 appears in SCOPe 2.04
- d2alaa1 appears in the current release, SCOPe 2.08
View in 3D
