Lineage for d1i9wa1 (1i9w A:293-380)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299774Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 1299810Protein Fusion glycoprotein E1 [74840] (1 species)
  7. 1299811Species Semliki forest virus [TaxId:11033] [74841] (4 PDB entries)
  8. 1299818Domain d1i9wa1: 1i9w A:293-380 [71163]
    Other proteins in same PDB: d1i9wa2

Details for d1i9wa1

PDB Entry: 1i9w (more details), 3 Å

PDB Description: crystal structure of the fusion glycoprotein e1 from semliki forest virus
PDB Compounds: (A:) fusion protein e1

SCOPe Domain Sequences for d1i9wa1:

Sequence, based on SEQRES records: (download)

>d1i9wa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasc

Sequence, based on observed residues (ATOM records): (download)

>d1i9wa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthsvltltyktnkngdcsvhshsnvatlqeatakvtlhfstasasp
sfvvslcsaratcsasc

SCOPe Domain Coordinates for d1i9wa1:

Click to download the PDB-style file with coordinates for d1i9wa1.
(The format of our PDB-style files is described here.)

Timeline for d1i9wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i9wa2