Lineage for d2aema1 (2aem A:113-244)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
automatically mapped to Pfam PF02254Protein Potassium channel-related protein MthK [75122] (1 species) Species Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (5 PDB entries) 
Domain d2aema1: 2aem A:113-244 [230508]
Other proteins in same PDB: d2aema2
automated match to d1lnqa3
Details for d2aema1
PDB Entry: 2aem (more details), 2.8 Å
PDB Description: Crystal Structures of the MthK RCK Domain
PDB Compounds: (A:) Calcium-gated potassium channel mthKSCOPe Domain Sequences for d2aema1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aema1 c.2.1.9 (A:113-244) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]}
aksrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlek
anvrgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispf
visgrlmsrsid
SCOPe Domain Coordinates for d2aema1:
Click to download the PDB-style file with coordinates for d2aema1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aema1:
- d2aema1 first appeared in SCOPe 2.03
- d2aema1 appears in SCOPe 2.04
- d2aema1 appears in SCOPe 2.06
- d2aema1 appears in the current release, SCOPe 2.08
View in 3D
