Lineage for d2a8ba_ (2a8b A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1367719Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1367720Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1368057Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 1368058Protein automated matches [190475] (5 species)
    not a true protein
  7. 1368067Species Human (Homo sapiens) [TaxId:9606] [187400] (65 PDB entries)
  8. 1368132Domain d2a8ba_: 2a8b A: [203401]
    automated match to d1yfoa_
    complexed with cl

Details for d2a8ba_

PDB Entry: 2a8b (more details), 2.3 Å

PDB Description: Crystal Structure of the Catalytic Domain of Human Tyrosine Phosphatase Receptor, Type R
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase R

SCOPe Domain Sequences for d2a8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8ba_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipsriltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtknryktilpnplsrv
clrpknvtdslstyinanyirgysgkekafiatqgpmintvddfwqmvwqedspvivmit
klkeknekcvlywpekrgiygkvevlvisvnecdnytirnlvlkqgshtqhvkhywytsw
pdhktpdsaqpllqlmldveedrlasqgrgpvvvhcsagigrtgcfiatsigcqqlkeeg
vvdalsivcqlrmdrggmvqtseqyefvhhalclyesrlsaet

SCOPe Domain Coordinates for d2a8ba_:

Click to download the PDB-style file with coordinates for d2a8ba_.
(The format of our PDB-style files is described here.)

Timeline for d2a8ba_: