Lineage for d2a4ca_ (2a4c A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1110686Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1110737Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 1110738Protein automated matches [190458] (2 species)
    not a true protein
  7. 1110742Species Mouse (Mus musculus) [TaxId:10090] [187373] (2 PDB entries)
  8. 1110744Domain d2a4ca_: 2a4c A: [162672]
    automated match to d1o6sb_

Details for d2a4ca_

PDB Entry: 2a4c (more details), 2.9 Å

PDB Description: Crystal structure of mouse cadherin-11 EC1
PDB Compounds: (A:) Cadherin-11

SCOPe Domain Sequences for d2a4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4ca_ b.1.6.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sgwvwnqffvieeytgpdpvlvgrlhsdidsgdgnikyilsgegagtifviddksgniha
tktldreeraqytlmaqavdrdtnrpleppsefivkvqd

SCOPe Domain Coordinates for d2a4ca_:

Click to download the PDB-style file with coordinates for d2a4ca_.
(The format of our PDB-style files is described here.)

Timeline for d2a4ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a4cb_