Lineage for d1zyua_ (1zyu A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845652Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 1845653Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 1845667Species Mycobacterium tuberculosis [TaxId:1773] [75194] (11 PDB entries)
    Uniprot P95014
  8. 1845680Domain d1zyua_: 1zyu A: [125869]
    automated match to d1l4ua_
    complexed with acp, skm

Details for d1zyua_

PDB Entry: 1zyu (more details), 2.9 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis shikimate kinase in complex with shikimate and amppcp at 2.85 angstrom resolution
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d1zyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyua_ c.37.1.2 (A:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvp

SCOPe Domain Coordinates for d1zyua_:

Click to download the PDB-style file with coordinates for d1zyua_.
(The format of our PDB-style files is described here.)

Timeline for d1zyua_: