Lineage for d1ztra1 (1ztr A:0-59)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families) 
consists only of helicesFamily a.4.1.1: Homeodomain [46690] (41 proteins)
Pfam PF00046
Protein Engrailed Homeodomain [46691] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries) 
Domain d1ztra1: 1ztr A:0-59 [125655]
Other proteins in same PDB: d1ztra2
mutant
Details for d1ztra1
PDB Entry: 1ztr (more details)
PDB Description: solution structure of engrailed homeodomain l16a mutant
PDB Compounds: (A:) Segmentation polarity homeobox protein engrailedSCOPe Domain Sequences for d1ztra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztra1 a.4.1.1 (A:0-59) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dekrprtafsseqlarakrefnenrylterrrqqlsselglneaqikiwfqnkrakirrs
SCOPe Domain Coordinates for d1ztra1:
Click to download the PDB-style file with coordinates for d1ztra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ztra1:
- d1ztra1 first appeared in SCOP 1.73
- d1ztra1 appears in SCOPe 2.06
- d1ztra1 appears in the current release, SCOPe 2.08
View in 3D
