![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Coagulation factor XI [117237] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117238] (45 PDB entries) Uniprot P03951 388-624 |
![]() | Domain d1zhra_: 1zhr A: [162481] automated match to d1xxda_ complexed with ben; mutant |
PDB Entry: 1zhr (more details), 1.73 Å
SCOPe Domain Sequences for d1zhra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhra_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
Timeline for d1zhra_: