Lineage for d1zd3a1 (1zd3 A:2-225)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.2: YihX-like [56789] (3 proteins)
the insertion subdomain is a 4-helical bundle
automatically mapped to Pfam PF13419
Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
has a lipid phosphatase activitySpecies Human (Homo sapiens) [TaxId:9606] [102303] (36 PDB entries) 
Domain d1zd3a1: 1zd3 A:2-225 [124930]
Other proteins in same PDB: d1zd3a2
automated match to d1vj5a1
complexed with 15p, mg, nc4, po4
Details for d1zd3a1
PDB Entry: 1zd3 (more details), 2.3 Å
PDB Description: Human soluble epoxide hydrolase 4-(3-cyclohexyluriedo)-butyric acid complex
PDB Compounds: (A:) epoxide hydrolase 2, cytoplasmicSCOPe Domain Sequences for d1zd3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zd3a1 c.108.1.2 (A:2-225) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap
SCOPe Domain Coordinates for d1zd3a1:
Click to download the PDB-style file with coordinates for d1zd3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zd3a1:
- d1zd3a1 first appeared in SCOP 1.73
- d1zd3a1 appears in SCOPe 2.07
View in 3D
