![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
![]() | Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries) |
![]() | Domain d1ykkb1: 1ykk B:301-538 [144654] Other proteins in same PDB: d1ykka_, d1ykkc_, d1ykke_, d1ykkg_, d1ykki_, d1ykkk_ complexed with fe; mutant |
PDB Entry: 1ykk (more details), 2.06 Å
SCOPe Domain Sequences for d1ykkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykkb1 b.3.6.1 (B:301-538) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]} paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
Timeline for d1ykkb1: