Lineage for d1xwya1 (1xwy A:1-260)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096556Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (5 proteins)
    automatically mapped to Pfam PF01026
  6. 2096557Protein Deoxyribonuclease TatD (MttC) [141811] (1 species)
  7. 2096558Species Escherichia coli [TaxId:562] [141812] (1 PDB entry)
    Uniprot P27859 1-260
  8. 2096559Domain d1xwya1: 1xwy A:1-260 [122411]
    complexed with zn

Details for d1xwya1

PDB Entry: 1xwy (more details), 2 Å

PDB Description: crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution
PDB Compounds: (A:) Deoxyribonuclease tatD

SCOPe Domain Sequences for d1xwya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]}
mfdigvnltssqfakdrddvvacafdagvngllitgtnlresqqaqklarqysscwstag
vhphdssqwqaateeaiielaaqpevvaigecgldfnrnfstpeeqerafvaqlriaadl
nmpvfmhcrdaherfmtllepwldklpgavlhcftgtreemqacvahgiyigitgwvcde
rrglelrellplipaekllietdapyllprdltpkpssrrnepahlphilqriahwrged
aawlaattdanvktlfgiaf

SCOPe Domain Coordinates for d1xwya1:

Click to download the PDB-style file with coordinates for d1xwya1.
(The format of our PDB-style files is described here.)

Timeline for d1xwya1: