Lineage for d1xw4x1 (1xw4 X:32-137)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)Superfamily d.268.1: ParB/Sulfiredoxin [110849] (4 families) 
Family d.268.1.4: Sulfiredoxin-like [160095] (2 proteins)
PfamB PB015736Protein Sulfiredoxin [160096] (1 species) Species Human (Homo sapiens) [TaxId:9606] [160097] (6 PDB entries)
Uniprot Q9BYN0 17-137! Uniprot Q9BYN0 28-137! Uniprot Q9BYN0 30-137
Domain d1xw4x1: 1xw4 X:32-137 [145892]
Other proteins in same PDB: d1xw4x2
complexed with adp
Details for d1xw4x1
PDB Entry: 1xw4 (more details), 2 Å
PDB Description: crystal structure of human sulfiredoxin (srx) in complex with adp
PDB Compounds: (X:) SulfiredoxinSCOPe Domain Sequences for d1xw4x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xw4x1 d.268.1.4 (X:32-137) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]}
sihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsvppidvlwikgaqggd
yfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdlq
SCOPe Domain Coordinates for d1xw4x1:
Click to download the PDB-style file with coordinates for d1xw4x1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xw4x1:
- d1xw4x1 first appeared in SCOP 1.75
- d1xw4x1 appears in SCOPe 2.05
- d1xw4x1 appears in SCOPe 2.07
- d1xw4x1 appears in the current release, SCOPe 2.08
View in 3D
