Lineage for d1xmea_ (1xme A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958596Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 1958597Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 1958598Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 1958616Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. 1958617Species Thermus thermophilus [TaxId:274] [81437] (25 PDB entries)
  8. 1958622Domain d1xmea_: 1xme A: [122143]
    Other proteins in same PDB: d1xmeb1, d1xmeb2, d1xmec_
    automated match to d1ehka_
    complexed with bng, cu, cua, gol, has, hem

Details for d1xmea_

PDB Entry: 1xme (more details), 2.3 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (A:) Cytochrome c oxidase polypeptide I

SCOPe Domain Sequences for d1xmea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmea_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy
yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll
aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym
avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya
iiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv
avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv
nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv
wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi
yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt
lvqlfghlnpvpgwrlw

SCOPe Domain Coordinates for d1xmea_:

Click to download the PDB-style file with coordinates for d1xmea_.
(The format of our PDB-style files is described here.)

Timeline for d1xmea_: