Lineage for d1v62a_ (1v62 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1785934Protein Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) [110180] (1 species)
  7. 1785935Species Human (Homo sapiens) [TaxId:9606] [110181] (2 PDB entries)
    Uniprot Q9C0E4 238-341
  8. 1785937Domain d1v62a_: 1v62 A: [108390]
    Structural genomics target

Details for d1v62a_

PDB Entry: 1v62 (more details)

PDB Description: solution structure of the 3rd pdz domain of grip2
PDB Compounds: (A:) KIAA1719 protein

SCOPe Domain Sequences for d1v62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgdtvanasgplmveivktpgsalgisltttslrnksvitidrikpasvvdrsga
lhpgdhilsidgtsmehcslleatkllasisekvrleilpvpqsqrplrpssgpssg

SCOPe Domain Coordinates for d1v62a_:

Click to download the PDB-style file with coordinates for d1v62a_.
(The format of our PDB-style files is described here.)

Timeline for d1v62a_: