Lineage for d1v38a_ (1v38 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1737578Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1737622Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1737667Protein Sam-domain protein samsn-1 [101248] (1 species)
  7. 1737668Species Mouse (Mus musculus) [TaxId:10090] [101249] (1 PDB entry)
  8. 1737669Domain d1v38a_: 1v38 A: [100280]

Details for d1v38a_

PDB Entry: 1v38 (more details)

PDB Description: solution structure of the sterile alpha motif (sam) domain of mouse samsn1
PDB Compounds: (A:) SAM-domain protein SAMSN-1

SCOPe Domain Sequences for d1v38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgrrenhqtiqeflerihlqeytstlllngyetlddlkdikeshlielniadped
rarllsaaesllsgpssg

SCOPe Domain Coordinates for d1v38a_:

Click to download the PDB-style file with coordinates for d1v38a_.
(The format of our PDB-style files is described here.)

Timeline for d1v38a_: