Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
Protein Sam-domain protein samsn-1 [101248] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [101249] (1 PDB entry) |
Domain d1v38a_: 1v38 A: [100280] |
PDB Entry: 1v38 (more details)
SCOPe Domain Sequences for d1v38a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgrrenhqtiqeflerihlqeytstlllngyetlddlkdikeshlielniadped rarllsaaesllsgpssg
Timeline for d1v38a_: