Lineage for d1uv6a_ (1uv6 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1810674Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1810675Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 1810676Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)
  8. 1810733Domain d1uv6a_: 1uv6 A: [100030]
    complexed with cce

Details for d1uv6a_

PDB Entry: 1uv6 (more details), 2.5 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with carbamylcholine
PDB Compounds: (A:) acetylcholine-binding protein

SCOPe Domain Sequences for d1uv6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uv6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d1uv6a_:

Click to download the PDB-style file with coordinates for d1uv6a_.
(The format of our PDB-style files is described here.)

Timeline for d1uv6a_: