Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein cytochrome b5 reductase [50427] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [117215] (1 PDB entry) Uniprot P00387 30-300 |
Domain d1umka1: 1umk A:30-153 [113312] Other proteins in same PDB: d1umka2 complexed with fad |
PDB Entry: 1umk (more details), 1.75 Å
SCOPe Domain Sequences for d1umka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} tpaitlespdikyplrlidreiishdtrrfrfalpspqhilglpvgqhiylsaridgnlv vrpytpissdddkgfvdlvikvyfkdthpkfpaggkmsqylesmqigdtiefrgpsgllv yqgk
Timeline for d1umka1: