Lineage for d1ujva_ (1ujv A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1785981Protein Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) [101719] (1 species)
  7. 1785982Species Human (Homo sapiens) [TaxId:9606] [101720] (5 PDB entries)
    Uniprot Q86UL8 412-522, 600-682, 774-865, 913-1015, 1141-1230
  8. 1785983Domain d1ujva_: 1ujv A: [99470]
    structural genomics; second PDZ domain

Details for d1ujva_

PDB Entry: 1ujv (more details)

PDB Description: solution structure of the second pdz domain of human membrane associated guanylate kinase inverted-2 (magi-2)
PDB Compounds: (A:) membrane associated guanylate kinase inverted-2 (magi-2)

SCOPe Domain Sequences for d1ujva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgqaelmtltivkgaqgfgftiadsptgqrvkqildiqgcpglcegdliveinqq
nvqnlshtevvdilkdcpigsetsliihrgsgpssg

SCOPe Domain Coordinates for d1ujva_:

Click to download the PDB-style file with coordinates for d1ujva_.
(The format of our PDB-style files is described here.)

Timeline for d1ujva_: