Lineage for d1tjca_ (1tjc A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.8: TPR-like [48452] (9 families) 
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
Protein Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 [117007] (1 species) Species Human (Homo sapiens) [TaxId:9606] [117008] (1 PDB entry)
Uniprot P13674 161-254
Domain d1tjca_: 1tjc A: [112440]
Details for d1tjca_
PDB Entry: 1tjc (more details), 2.3 Å
PDB Description: crystal structure of peptide-substrate-binding domain of human type i collagen prolyl 4-hydroxylase
PDB Compounds: (A:) Prolyl 4-hydroxylase alpha-1 subunitSCOPe Domain Sequences for d1tjca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}
mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
dldkallltkklleldpehqrangnlkyfeyimak
SCOPe Domain Coordinates for d1tjca_:
Click to download the PDB-style file with coordinates for d1tjca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tjca_:
- d1tjca_ first appeared in SCOP 1.71
- d1tjca_ appears in SCOPe 2.04
- d1tjca_ appears in SCOPe 2.06
- d1tjca_ appears in the current release, SCOPe 2.08
View in 3D
